Level

Wells Fargo

Lead Java Software Engineer- Fixed Income Spread Technology

AI in this role

Lead Java Software Engineer designing and developing low-latency eTrading, pricing, and risk applications for fixed income markets.

javaspringangularkafkaapache-ignitemavengradlesonarqubetypescript
software-engineeringbackend-developmentfrontend-developmentdistributed-systemstrading-systems

About this role:

Wells Fargo is seeking a Lead Java Engineer to join the Spread Technology team in Fixed Income, supporting asset classes such as Structured Products, Credit, and Municipal Bonds. This role is pivotal to the success of strategic initiatives Front Office Sales and Trading applications, and is designed for engineers who thrive in high-performance, front-to-back delivery environments.


You will lead the design and development of low-latency Micro UIs and robust backend services, contributing to pricing and risk workflows. The ideal candidate will demonstrate technical leadership, deep domain knowledge in capital markets, and a passion for building scalable, resilient software solutions using modern technologies such as Angular, Java, Spring, Kafka, and Apache Ignite.


In this role, you will:

  • Lead complex initiatives on selected domains
  • Ensure systems are monitored to increase operational efficiency and managed to mitigate risk
  • Define opportunities to maximize resource utilization and improve processes while reducing cost
  • Lead, design, develop, test and implement applications and system components, tools and utilities, models, simulation, and analytics to manage complex business functions using sophisticated technologies
  • Resolve coding, testing and escalated platform issues of a technically challenging nature
  • Lead team to ensure compliance and risk management requirements for supported area are met and work with other stakeholders to implement key risk initiatives
  • Mentor less experienced software engineers
  • Collaborate and influence all levels of professionals including managers
  • Lead team to achieve objectivesDesign low latency eTrading, pricing, and risk applications for Fixed Income asset classes such as Structured Products, Credit, and Municipal Bonds
  • Implement low-latency, HTTP and WebSocket-based real-time micro UIs using JavaScript/Typescript, Angular, AgGrid, and other UI libraries
  • Develop backend services using Java, Spring Framework, Kafka, and Ignite
  • Utilize build tools such as Maven or Gradle and ensure code quality using SonarQube.
  • Provide technical support and resolve issues related to supported applications
  • Create test data and conduct interface and unit tests.
  • Design, code, test, debug, and document programs using Agile development practices
  • Partner with production support and platform engineering teams effectively


Required Qualifications:

  • 5+ years of Specialty Software Engineering experience, or equivalent demonstrated through one or a combination of the following: work experience, training, military experience, education
  • 3+ years of Capital Markets Fixed Income domain
  • 3+ years of Bond Pricing, Bond Risk, Bond PnL, and Position Management
  • 3+ years of experience in high-performance programming using Java or Python
  • 3+ years of experience in full stack development using Angular/Typescript for front-end and Java with Spring Framework for back-end
  • 3+ years of experience with Apache Kafka for messaging and stream processing



Desired Qualifications:

  • Experience using OpenShift / Kubernetes container platforms
  • Experience designing and delivering cloud-native, microservices-oriented solutions at enterprise scale in financial services or regulated sectors
  • Experience with test automation using tools such as Selenium.
  • Strong understanding of performance and stress testing web UIs using Chrome DevTools
  • 5+ years of experience with Apache Kafka for messaging and stream processing
  • 5+ years of experience with Apache Ignite for in-memory computing.
  • 5+ years of experience with build tools such as Maven or Gradle
  • 5+ years of experience with code quality tools like SonarQube
  • 5+ years of experience as a Full Stack Developer with strong understanding of front-end and back-end development
  • 5+ years of experience with monitoring and observability tools such as Splunk, Grafana, AppDynamics, New Relic, Elastic, or Open Telemetry

Job Expectations:

  • This position offers a hybrid work schedule
  • This position is not eligible for Visa sponsorship
  • Relocation assistance is not available for this position

Posting Locations:

  • 300 S Brevard St., Charlotte, NC 28202


Pay Range
 


Reflected is the base pay range offered for this position. Pay may vary depending on factors including but not limited to demonstrated examples of prior performance, skills, experience, or work location. Employees may also be eligible for incentive opportunities.
$159,000.00 - $254,000.00

Benefits

Wells Fargo provides eligible employees with a comprehensive set of benefits, many of which are listed below. Visit Benefits - Wells Fargo Jobs for an overview of the following benefit plans and programs offered to employees.

  • Health benefits
  • 401(k) Plan
  • Paid time off
  • Disability benefits
  • Life insurance, critical illness insurance, and accident insurance
  • Parental leave
  • Critical caregiving leave
  • Discounts and savings
  • Commuter benefits
  • Tuition reimbursement
  • Scholarships for dependent children
  • Adoption reimbursement

Posting End Date:

24 Nov 2026

*Job posting may come down early due to volume of applicants.

We Value Equal Opportunity

Wells Fargo is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, disability, status as a protected veteran, or any other legally protected characteristic.

Employees support our focus on building strong customer relationships balanced with a strong risk mitigating and compliance-driven culture which firmly establishes those disciplines as critical to the success of our customers and company. They are accountable for execution of all applicable risk programs (Credit, Market, Financial Crimes, Operational, Regulatory Compliance), which includes effectively following and adhering to applicable Wells Fargo policies and procedures, appropriately fulfilling risk and compliance obligations, timely and effective escalation and remediation of issues, and making sound risk decisions. There is emphasis on proactive monitoring, governance, risk identification and escalation, as well as making sound risk decisions commensurate with the business unit’s risk appetite and all risk and compliance program requirements.

Applicants with Disabilities

To request a medical accommodation during the application or interview process, visit Disability Inclusion at Wells Fargo.

Drug and Alcohol Policy

 

Wells Fargo maintains a drug free workplace.  Please see our Drug and Alcohol Policy to learn more.

Wells Fargo Recruitment and Hiring Requirements:

a. Third-Party recordings are prohibited unless authorized by Wells Fargo.

b. Wells Fargo requires you to directly represent your own experiences during the recruiting and hiring process.

How we rate this

Lead Java Software Engineer- Fixed Income Spread Technology at Wells Fargo rates 0 out of 100 for how much of the daily work is AI. That makes it Little AI (AI Level 1 of 4). The level is about AI in the job, not seniority.

Classification

Little AI. AI is not part of the work.

  1. ●●●● Builds AI80 to 100
  2. ●●●○ Works on AI60 to 79
  3. ●●○○ Uses AI40 to 59
  4. ●○○○ Little AI0 to 39

Levels come from how often the tools, models and workflows of the role are named in the posting itself. Open the description and count.

Prepare for this job

A free preview built only from this posting: what it asks for, what you could be asked in an interview, and how to adjust your resume.

Skills and AI tools this role asks for

Software EngineeringBackend DevelopmentFrontend DevelopmentDistributed SystemsTrading SystemsJavaSpringAngular

Questions you could be asked

  1. Tell me about a project where software engineering was part of your work. What did you do?
  2. Tell me about a project where backend development was part of your work. What did you do?
  3. Tell me about a project where frontend development was part of your work. What did you do?
  4. Tell me about a project where distributed systems was part of your work. What did you do?
  5. Tell me about a project where trading systems was part of your work. What did you do?

Adapt your resume

  • List these exact terms on your resume: Software Engineering, Backend Development, Frontend Development, Distributed Systems, and Trading Systems. An applicant tracking system matches the wording, not the idea.
  • Attach one line of real, concrete experience to at least one of them — a tool named with nothing behind it rarely survives a human read.

Want an expert to read your CV for this job?

Free. Send your CV and the role you want next. We reply by email within 2 to 4 business days.

Get a free CV review

Get new software engineer jobs by email

One email a week with the new software engineer jobs, each rated for how much AI is in the work. No recruiter spam, unsubscribe in one click.

Free. One email a week. Unsubscribe in one click.

Similar roles

Software Engineering roles that involve little AI, at other companies.

What kind of AI work fits you?

Answer 12 practical questions in about three minutes. Get a simple profile, the work it points to, and live roles to explore next.

Find my next step

More jobs at Wells Fargo

More software engineer jobs

Related searches

Same AI level